быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
CD31/PECAM1 Rabbit mAb (A19014)
- Описание
- Характеристики
-
Overview
Product name CD31/PECAM1 Rabbit mAb Catalog No. A19014 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC50362 Background
The protein encoded by this gene is found on the surface of platelets, monocytes, neutrophils, and some types of T-cells, and makes up a large portion of endothelial cell intercellular junctions. The encoded protein is a member of the immunoglobulin superfamily and is likely involved in leukocyte migration, angiogenesis, and integrin activation.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 630-738 of CD31/PECAM1 (NP_000433.4). Sequence AKQMPVEMSRPAVPLLNSNNEKMSDPNMEANSHYGHNDDVRNHAMKPINDNKEPLNSDVQYTEVQVSSAESHKDLGKKDTETVYSEVRKAVPDAVESRYSRTEGSLDGT Gene ID Swiss Prot Synonyms CD31; PECA1; GPIIA'; PECAM-1; endoCAM; CD31/EndoCAM Calculated MW 83kDa Observed MW 135kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IHC-P IF/ICC Recommended dilution - WB 1:2000 -1:10000
- IHC-P 1:500 - 1:1000
- IF/ICC 1:100 - 1:500
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Immunofluorescence Positive samples THP-1 cells, Mouse lung, Rat lung Cellular location Cell junction, Cell junction, Cell membrane, Lipid-anchor, Single-pass type I membrane protein Customer validation IF(Homo sapiens, Mus musculus)
IHC(Homo sapiens, Rattus norvegicus)
WB(Mus musculus)
Western blot analysis of various lysates, using CD31/PECAM1 (A19014) at 1:12500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.
Western blot analysis of various lysates, using CD31/PECAM1 (A19014) at 1:12500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 180s.
Immunohistochemistry analysis of paraffin-embedded human kidney using CD31/PECAM1 Rabbit mAb (A19014) at dilution of 1:2000 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded human liver using CD31/PECAM1 Rabbit mAb (A19014) at dilution of 1:2000 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded human thyroid using CD31/PECAM1 Rabbit mAb (A19014) at dilution of 1:2000 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunofluorescence analysis of Human placenta using CD31/PECAM1 Rabbit mAb (A19014) at dilution of 1:300 (40x lens). Blue: DAPI for nuclear staining.
Immunofluorescence analysis of Rat small colon using CD31/PECAM1 Rabbit mAb (A19014) at dilution of 1:300 (40x lens). Blue: DAPI for nuclear staining.
-
Key applications Western blotting, Immunohistochemistry, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 630-738 of CD31/PECAM1 (NP_000433.4). KO Validated Validated Isotype IgG
