быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
CD34 Rabbit mAb (A19015)
- Описание
- Характеристики
-
Overview
Product name CD34 Rabbit mAb Catalog No. A19015 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC0219 Background
The protein encoded by this gene may play a role in the attachment of stem cells to the bone marrow extracellular matrix or to stromal cells. This single-pass membrane protein is highly glycosylated and phosphorylated by protein kinase C. Two transcript variants encoding different isoforms have been found for this gene.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 286-385 of human CD34 (P28906). Sequence YSQKTLIALVTSGALLAVLGITGYFLMNRRSWSPTGERLGEDPYYTENGGGQGYSSGPGTSPEAQGKASVNRGAQENGTGQATSRNGHSARQHVVADTEL Gene ID Swiss Prot Synonyms CD34; CD34 molecule; GIG3; MORT1 Calculated MW 41kDa Observed MW 120kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IHC-P Recommended dilution - WB 1:500 - 1:1000
- IHC-P 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Positive samples Mouse testis, Rat lung Cellular location Membrane, Single-pass type I membrane protein Customer validation WB(Homo sapiens,Mus musculus)
IHC(Homo sapiens, Rat)
Western blot analysis of extracts of various cell lines, using CD34 antibody (A19015) at 1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3min.
Immunohistochemistry of paraffin-embedded human colon carcinoma using CD34 Rabbit mAb (A19015) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Immunohistochemistry of paraffin-embedded human kidney using CD34 Rabbit mAb (A19015) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Immunohistochemistry of paraffin-embedded human lung cancer using CD34 Rabbit mAb (A19015) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Immunohistochemistry of paraffin-embedded human tonsil using CD34 Rabbit mAb (A19015) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
-
Key applications Western blotting, Immunohistochemistry Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 286-385 of human CD34 (P28906). KO Validated Validated Isotype IgG