быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
CD63 Rabbit mAb (A19023)
- Описание
- Характеристики
-
Overview
Product name CD63 Rabbit mAb Catalog No. A19023 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC51703 Background
The protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. The encoded protein is a cell surface glycoprotein that is known to complex with integrins. It may function as a blood platelet activation marker. Deficiency of this protein is associated with Hermansky-Pudlak syndrome. Also this gene has been associated with tumor progression. Alternative splicing results in multiple transcript variants encoding different protein isoforms.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 103-203 of human CD63 (NP_001771.1). Sequence AGYVFRDKVMSEFNNNFRQQMENYPKNNHTASILDRMQADFKCCGAANYTDWEKIPSMSKNRVPDSCCINVTVGCGINFNEKAIHKEGCVEKIGGWLRKNV Gene ID Swiss Prot Synonyms MLA1; ME491; LAMP-3; OMA81H; TSPAN30 Calculated MW 17kDa/23kDa/25kDa Observed MW 30-65kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IHC-P Recommended dilution - WB 1:500 - 1:1000
- IHC-P 1:2000 - 1:10000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Positive samples A375, RAW 264.7, Mouse kidney Cellular location Cell membrane, Endosome, Late endosome membrane, Lysosome membrane, Melanosome, Multi-pass membrane protein, multivesicular body Customer validation WB(Homo sapiens, Danio rerio, Mus musculus, beagle dogs , Canis lupus familiaris, mouse, Rattus norvegicus)
Western blot analysis of A375, using CD63 antibody (A19023) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.
Western blot analysis of various lysates, using CD63 Rabbit mAb (A19023) at 1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 90s.
Immunohistochemistry of paraffin-embedded human colon using CD63 Rabbit mAb (A19023) at dilution of 1:10000 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry of paraffin-embedded human tonsil using CD63 Rabbit mAb (A19023) at dilution of 1:10000 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
-
Key applications Western blotting, Immunohistochemistry Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 103-203 of human CD63 (NP_001771.1). KO Validated Validated Isotype IgG