быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
CD80 Rabbit mAb (A19025)
- Описание
- Характеристики
-
Overview
Product name CD80 Rabbit mAb Catalog No. A19025 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC0384 Background
The protein encoded by this gene is a membrane receptor that is activated by the binding of CD28 or CTLA-4. The activated protein induces T-cell proliferation and cytokine production. This protein can act as a receptor for adenovirus subgroup B and may play a role in lupus neuropathy.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 189-288 of human CD80 (P33681). Sequence VSQDPETELYAVSSKLDFNMTTNHSFMCLIKYGHLRVNQTFNWNTTKQEHFPDNLLPSWAITLISVNGIFVICCLTYCFAPRCRERRRNERLRRESVRPV Gene ID Swiss Prot Synonyms B7; BB1; B7-1; B7.1; LAB7; CD28LG; CD28LG1 Calculated MW 33kDa Observed MW 50-75kDa Applications
Reactivity Human Tested applications WB Recommended dilution - WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples Raji, K-562 Cellular location Membrane, Single-pass type I membrane protein 
Western blot analysis of extracts of various cell lines, using CD80 antibody (A19025) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек Immunogen A synthetic peptide corresponding to a sequence within amino acids 189-288 of human CD80 (P33681). Isotype IgG