быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
CD86 Rabbit mAb (A19026)
- Описание
- Характеристики
-
Overview
Product name CD86 Rabbit mAb Catalog No. A19026 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC0333 Background
This gene encodes a type I membrane protein that is a member of the immunoglobulin superfamily. This protein is expressed by antigen-presenting cells, and it is the ligand for two proteins at the cell surface of T cells, CD28 antigen and cytotoxic T-lymphocyte-associated protein 4. Binding of this protein with CD28 antigen is a costimulatory signal for activation of the T-cell. Binding of this protein with cytotoxic T-lymphocyte-associated protein 4 negatively regulates T-cell activation and diminishes the immune response. Alternative splicing results in several transcript variants encoding different isoforms.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human CD86 (P42081). Sequence MDPQCTMGLSNILFVMAFLLSGAAPLKIQAYFNETADLPCQFANSQNQSLSELVVFWQDQENLVLNEVYLGKEKFDSVHSKYMGRTSFDSDSWTLRLHNL Gene ID Swiss Prot Synonyms B70; B7-2; B7.2; LAB72; CD28LG2 Calculated MW 38kDa Observed MW 80kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB Recommended dilution - WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples Raji, Jurkat, U-251MG, Mouse spleen, Mouse liver, Rat thymus Cellular location Cell membrane, Single-pass type I membrane protein Customer validation WB(Mus musculus, Homo sapiens, Rattus norvegicus)

Western blot analysis of extracts of various cell lines, using CD86 antibody (A19026) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human CD86 (P42081). Isotype IgG







