быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
CHAT Rabbit mAb (A19031)
- Описание
- Характеристики
-
Overview
Product name CHAT Rabbit mAb Catalog No. A19031 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC0491 Background
This gene encodes an enzyme which catalyzes the biosynthesis of the neurotransmitter acetylcholine. This gene product is a characteristic feature of cholinergic neurons, and changes in these neurons may explain some of the symptoms of Alzheimer's disease. Polymorphisms in this gene have been associated with Alzheimer's disease and mild cognitive impairment. Mutations in this gene are associated with congenital myasthenic syndrome associated with episodic apnea. Multiple transcript variants encoding different isoforms have been found for this gene, and some of these variants have been shown to encode more than one isoform.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 649-748 of human CHAT (P28329). Sequence MSNRFVLSTSQVPTTTEMFCCYGPVVPNGYGACYNPQPETILFCISSFHSCKETSSSKFAKAVEESLIDMRDLCSLLPPTESKPLATKEKATRPSQGHQP Gene ID Swiss Prot Synonyms CMS6; CMS1A; CMS1A2; CHOACTASE Calculated MW 83kDa Observed MW 65kDa Applications
Reactivity Human, Mouse，Rat Tested applications WB IF/ICC Recommended dilution - WB 1:500 - 1:2000
- IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunofluorescence Positive samples SH-SY5Y Cellular location cytoplasm, cytosol, neuron projection, nucleus, synapse 
Western blot analysis of extracts of SH-SY5Y cells, using CHAT antibody (A19031) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5s.
Immunofluorescence analysis of SH-SY5Y cells using CHAT Rabbit mAb (A19031) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
-
Key applications Western blotting, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 649-748 of human CHAT (P28329). Isotype IgG