быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
Cullin 1 Rabbit mAb (A19034)
- Описание
- Характеристики
-
Overview
Product name Cullin 1 Rabbit mAb Catalog No. A19034 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC0436 Background
Predicted to enable ubiquitin protein ligase binding activity and ubiquitin-protein transferase activity. Involved in SCF-dependent proteasomal ubiquitin-dependent protein catabolic process and protein ubiquitination. Located in plasma membrane. Part of Parkin-FBXW7-Cul1 ubiquitin ligase complex and SCF ubiquitin ligase complex.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 677-776 of human Cullin 1 (Q13616). Sequence NKKLRVNINVPMKTEQKQEQETTHKNIEEDRKLLIQAAIVRIMKMRKVLKHQQLLGEVLTQLSSRFKPRVPVIKKCIDILIEKEYLERVDGEKDTYSYLA Gene ID Swiss Prot Synonyms Cullin 1; CUL1; cullin-1; MGC149834; MGC149835 Calculated MW 90kDa Observed MW 90kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB Recommended dilution - WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples A-549, K-562, MCF7, NIH/3T3, Mouse liver, Mouse brain, Rat testis Cellular location cytosol, nucleoplasm, plasma membrane 
Western blot analysis of extracts of various cell lines, using Cullin 1 antibody (A19034) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 677-776 of human Cullin 1 (Q13616). Isotype IgG