быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
Cytokeratin 19 (CK19) Rabbit mAb (A19040)
- Описание
- Характеристики
-
Overview
Product name Cytokeratin 19 (CK19) Rabbit mAb Catalog No. A19040 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC2811 Background
The protein encoded by this gene is a member of the keratin family. The keratins are intermediate filament proteins responsible for the structural integrity of epithelial cells and are subdivided into cytokeratins and hair keratins. The type I cytokeratins consist of acidic proteins which are arranged in pairs of heterotypic keratin chains. Unlike its related family members, this smallest known acidic cytokeratin is not paired with a basic cytokeratin in epithelial cells. It is specifically expressed in the periderm, the transiently superficial layer that envelopes the developing epidermis. The type I cytokeratins are clustered in a region of chromosome 17q12-q21.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Cytokeratin 19 (KRT19) (KRT19) (P08727). Sequence MTSYSYRQSSATSSFGGLGGGSVRFGPGVAFRAPSIHGGSGGRGVSVSSARFVSSSSSGAYGGGYGGVLTASDGLLAGNEKLTMQNLNDRLASYLDKVRA Gene ID Swiss Prot Synonyms K19; KRT19; K1CS Calculated MW 44kDa Observed MW 43kDa Applications
Reactivity Human Tested applications WB IHC-P IF/ICC Recommended dilution - WB 1:100 - 1:500
- IHC-P 1:50 - 1:200
- IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Immunofluorescence Positive samples BxPC-3 cells, MCF7 cells Cellular location Cytoplasm Customer validation IHC(Mus musculus, Homo sapiens, Rattus norvegicus)
IF(Homo sapiens)
ELISA(Homo sapiens)
Western blot analysis of various lysates, using Cytokeratin 19 (CK19) Rabbit mAb (A19040) at 1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 0.5s.
Immunohistochemistry of paraffin-embedded human breast cancer using Cytokeratin 19 (CK19) Rabbit mAb (A19040) at dilution of 1:20 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry of paraffin-embedded human colon carcinoma using Cytokeratin 19 (CK19) Rabbit mAb (A19040) at dilution of 1:20 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry of paraffin-embedded human liver using Cytokeratin 19 (CK19) Rabbit mAb (A19040) at dilution of 1:20 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry of paraffin-embedded human placenta using Cytokeratin 19 (CK19) Rabbit mAb (A19040) at dilution of 1:20 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunofluorescence analysis of MCF7 cells using Cytokeratin 19 (KRT19) Rabbit mAb (A19040) at dilution of 1:20 (40x lens). Blue: DAPI for nuclear staining.
-
Key applications Western blotting, Immunohistochemistry, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Человек Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Cytokeratin 19 (KRT19) (KRT19) (P08727). KO Validated Validated Isotype IgG