быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
Cytokeratin 20 (CK20) Rabbit mAb (A19041)
- Описание
- Характеристики
-
Overview
Product name Cytokeratin 20 (CK20) Rabbit mAb Catalog No. A19041 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC0288 Background
The protein encoded by this gene is a member of the keratin family. The keratins are intermediate filament proteins responsible for the structural integrity of epithelial cells and are subdivided into cytokeratins and hair keratins. The type I cytokeratins consist of acidic proteins which are arranged in pairs of heterotypic keratin chains. This cytokeratin is a major cellular protein of mature enterocytes and goblet cells and is specifically expressed in the gastric and intestinal mucosa. The type I cytokeratin genes are clustered in a region of chromosome 17q12-q21.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 325-424 of human Cytokeratin 20 (KRT20) (P35900). Sequence LANLQSLLSSLEAQLMQIRSNMERQNNEYHILLDIKTRLEQEIATYRRLLEGEDVKTTEYQLSTLEERDIKKTRKIKTVVQEVVDGKVVSSEVKEVEENI Gene ID Swiss Prot Synonyms K20; CD20; KRT20; CK-20; KRT21 Calculated MW 48kDa Observed MW 44kDa Applications
Reactivity Human, Rat Tested applications WB IHC-P Recommended dilution - WB 1:500 - 1:1000
- IHC-P 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Positive samples HT-29 cells, Rat liver Cellular location Cytoplasm 
Western blot analysis of extracts of HT-29 cells, using Cytokeratin 20 (KRT20) (KRT20) antibody (A19041) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.
Western blot analysis of extracts of Rat liver, using Cytokeratin 20 (KRT20) (KRT20) antibody (A19041) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 3min.
Immunohistochemistry analysis of paraffin-embedded human stomach using Cytokeratin 20 (KRT20) Rabbit mAb (A19041) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
-
Key applications Western blotting, Immunohistochemistry Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 325-424 of human Cytokeratin 20 (KRT20) (P35900). KO Validated Validated Isotype IgG