быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
FADD Rabbit mAb (A19049)
- Описание
- Характеристики
-
Overview
Product name FADD Rabbit mAb Catalog No. A19049 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC0415 Background
The protein encoded by this gene is an adaptor molecule that interacts with various cell surface receptors and mediates cell apoptotic signals. Through its C-terminal death domain, this protein can be recruited by TNFRSF6/Fas-receptor, tumor necrosis factor receptor, TNFRSF25, and TNFSF10/TRAIL-receptor, and thus it participates in the death signaling initiated by these receptors. Interaction of this protein with the receptors unmasks the N-terminal effector domain of this protein, which allows it to recruit caspase-8, and thereby activate the cysteine protease cascade. Knockout studies in mice also suggest the importance of this protein in early T cell development.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 20-150 of human FADD (Q13158). Sequence LTELKFLCLGRVGKRKLERVQSGLDLFSMLLEQNDLEPGHTELLRELLASLRRHDLLRRVDDFEAGAAAGAAPGEEDLCAAFNVICDNVGKDWRRLARQLKVSDTKIDSIEDRYPRNLTERVRESLRIWKN Gene ID Swiss Prot Synonyms GIG3; IMD90; MORT1 Calculated MW 23kDa Observed MW 25kDa Applications
Reactivity Human Tested applications WB Recommended dilution - WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples HeLa, A431, U-251MG Cellular location cytoplasm, cytosol, neuron projection, nucleus, plasma membrane 
Western blot analysis of extracts of various cell lines, using FADD antibody (A19049) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 20-150 of human FADD (Q13158). Isotype IgG