быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
Fatty Acid Synthase (FASN) Rabbit mAb (A19050)
- Описание
- Характеристики
-
Overview
Product name Fatty Acid Synthase (FASN) Rabbit mAb Catalog No. A19050 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC0377 Background
The enzyme encoded by this gene is a multifunctional protein. Its main function is to catalyze the synthesis of palmitate from acetyl-CoA and malonyl-CoA, in the presence of NADPH, into long-chain saturated fatty acids. In some cancer cell lines, this protein has been found to be fused with estrogen receptor-alpha (ER-alpha), in which the N-terminus of FAS is fused in-frame with the C-terminus of ER-alpha.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 2400-2500 of human FASN (P49327). Sequence AVDLIIKSHQGLDRQELSFAARSFYYKLRAAEQYTPKAKYHGNVMLLRAKTGGAYGEDLGADYNLSQVCDGKVSVHVIEGDHRTLLEGSGLESIISIIHSS Gene ID Swiss Prot Synonyms FAS; OA-519; SDR27X1 Calculated MW 273kDa Observed MW 273kDa Applications
Reactivity Human, Mouse Tested applications WB IHC-P IF/ICC IP Recommended dilution - WB 1:500 - 1:2000
- IHC-P 1:50 - 1:200
- IF/ICC 1:50 - 1:200
- IP 1:100 - 1:500
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Immunofluorescence Immunoprecipitation Positive samples A549, HeLa Cellular location Cytoplasm, Melanosome Customer validation WB(Mus musculus, Homo sapiens)
Western blot analysis of extracts of various cell lines, using Fatty Acid Synthase (FASN) antibody (A19050) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 3min.
Immunohistochemistry analysis of paraffin-embedded human colon carcinoma using Fatty Acid Synthase (FASN) Rabbit mAb (A19050) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Immunofluorescence analysis of NIH/3T3 cells using Fatty Acid Synthase (FASN) Rabbit mAb (A19050) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunofluorescence analysis of HeLa cells using Fatty Acid Synthase (FASN) Rabbit mAb (A19050) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunoprecipitation analysis of 300 μg extracts of HeLa cells using 3 μg Fatty Acid Synthase (FASN) antibody (A19050). Western blot was performed from the immunoprecipitate using Fatty Acid Synthase (FASN) antibody (A19050) at a dilution of 1:500.
-
Key applications Western blotting, Immunohistochemistry, Immunofluorescence, Immunoprecipitation Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь Immunogen A synthetic peptide corresponding to a sequence within amino acids 2400-2500 of human FASN (P49327). Isotype IgG