быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
FGFR3 Rabbit mAb (A19052)
- Описание
- Характеристики
-
Overview
Product name FGFR3 Rabbit mAb Catalog No. A19052 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC0398 Background
This gene encodes a member of the fibroblast growth factor receptor (FGFR) family, with its amino acid sequence being highly conserved between members and among divergent species. FGFR family members differ from one another in their ligand affinities and tissue distribution. A full-length representative protein would consist of an extracellular region, composed of three immunoglobulin-like domains, a single hydrophobic membrane-spanning segment and a cytoplasmic tyrosine kinase domain. The extracellular portion of the protein interacts with fibroblast growth factors, setting in motion a cascade of downstream signals, ultimately influencing mitogenesis and differentiation. This particular family member binds acidic and basic fibroblast growth hormone and plays a role in bone development and maintenance. Mutations in this gene lead to craniosynostosis and multiple types of skeletal dysplasia.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human FGFR3 (P22607). Sequence MGAPACALALCVAVAIVAGASSESLGTEQRVVGRAAEVPGPEPGQQEQLVFGSGDAVELSCPPPGGGPMGPTVWVKDGTGLVPSERVLVGPQRLQVLNAS Gene ID Swiss Prot Synonyms ACH; CEK2; JTK4; CD333; HSFGFR3EX Calculated MW 88kDa Observed MW 110kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IHC-P Recommended dilution - WB 1:500 - 1:1000
- IHC-P 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Positive samples 293T, Mouse brain, Mouse lung, Rat lung, Rat kidney Cellular location Cell membrane, Cytoplasmic vesicle, Endoplasmic reticulum, Secreted, Single-pass type I membrane protein Customer validation WB(Rattus norvegicus, Homo sapiens)
Western blot analysis of extracts of various cell lines, using FGFR3 antibody (A19052) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3min.
Immunohistochemistry analysis of paraffin-embedded human esophageal cancer using FGFR3 Rabbit mAb (A19052) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
-
Key applications Western blotting, Immunohistochemistry Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human FGFR3 (P22607). Isotype IgG