быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
HNF3β/FOXA2 Rabbit mAb (A19053)
- Описание
- Характеристики
-
Overview
Product name HNF3β/FOXA2 Rabbit mAb Catalog No. A19053 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC0391 Background
This gene encodes a member of the forkhead class of DNA-binding proteins. These hepatocyte nuclear factors are transcriptional activators for liver-specific genes such as albumin and transthyretin, and they also interact with chromatin. Similar family members in mice have roles in the regulation of metabolism and in the differentiation of the pancreas and liver. This gene has been linked to sporadic cases of maturity-onset diabetes of the young. Transcript variants encoding different isoforms have been identified for this gene.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human HNF3β/FOXA2 (Q9Y261). Sequence MLGAVKMEGHEPSDWSSYYAEPEGYSSVSNMNAGLGMNGMNTYMSMSAAAMGSGSGNMSAGSMNMSSYVGAGMSPSLAGMSPGAGAMAGMGGSAGAAGVA Gene ID Swiss Prot Synonyms HNF3B; TCF3B; HNF-3-beta Calculated MW 48kDa Observed MW 52kDa Applications
Reactivity Human, Rat Tested applications WB IF/ICC IP Recommended dilution - WB 1:500 - 1:2000
- IF/ICC 1:50 - 1:200
- IP 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunofluorescence Immunoprecipitation Positive samples HepG2, Rat lung Cellular location Cytoplasm, Nucleus Customer validation ICC(Homo sapiens)
IF(Homo sapiens)
Western blot analysis of extracts of various cell lines, using HNF3β/HNF3β/FOXA2 antibody (A19053) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3min.
Immunofluorescence analysis of Hep G2 cells using HNF3β/HNF3β/FOXA2 Rabbit mAb (A19053) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunoprecipitation analysis of 300 μg extracts of HepG2 cells using 3 μg HNF3β/FOXA2 antibody (A19053). Western blot was performed from the immunoprecipitate using HNF3β/FOXA2 antibody (A19053) at a dilution of 1:1000.
-
Key applications Western blotting, Immunofluorescence, Immunoprecipitation Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human HNF3β/FOXA2 (Q9Y261). Isotype IgG