быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
Glucosylceramidase beta (GBA) Rabbit mAb (A19057)
- Описание
- Характеристики
-
Overview
Product name Glucosylceramidase beta (GBA) Rabbit mAb Catalog No. A19057 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC0500 Background
This gene encodes a lysosomal membrane protein that cleaves the beta-glucosidic linkage of glycosylceramide, an intermediate in glycolipid metabolism. Mutations in this gene cause Gaucher disease, a lysosomal storage disease characterized by an accumulation of glucocerebrosides. A related pseudogene is approximately 12 kb downstream of this gene on chromosome 1. Alternative splicing results in multiple transcript variants.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 437-536 of human Glucosylceramidase beta (GBA) (P04062). Sequence VDSPIIVDITKDTFYKQPMFYHLGHFSKFIPEGSQRVGLVASQKNDLDAVALMHPDGSAVVVVLNRSSKDVPLTIKDPAVGFLETISPGYSIHTYLWRRQ Gene ID Swiss Prot Synonyms GBA; GCB; GLUC Calculated MW 60kDa Observed MW 60kDa Applications
Reactivity Human, Rat Tested applications WB IHC-P Recommended dilution - WB 1:500 - 1:2000
- IHC-P 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Positive samples SH-SY5Y, MCF7, Rat brain Cellular location Lumenal side, Lysosome membrane, Peripheral membrane protein 
Western blot analysis of extracts of various cell lines, using Glucosylceramidase beta (Glucosylceramidase beta (GBA)) antibody (A19057) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
Western blot analysis of extracts of Rat brain, using Glucosylceramidase beta (Glucosylceramidase beta (GBA)) antibody (A19057) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3min.
Immunohistochemistry analysis of paraffin-embedded human liver using Glucosylceramidase beta (Glucosylceramidase beta (GBA)) Rabbit mAb (A19057) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
-
Key applications Western blotting, Immunohistochemistry Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 437-536 of human Glucosylceramidase beta (GBA) (P04062). Isotype IgG