быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
GFAP Rabbit mAb (A19058)
- Описание
- Характеристики
-
Overview
Product name GFAP Rabbit mAb Catalog No. A19058 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC0206 Background
This gene encodes one of the major intermediate filament proteins of mature astrocytes. It is used as a marker to distinguish astrocytes from other glial cells during development. Mutations in this gene cause Alexander disease, a rare disorder of astrocytes in the central nervous system. Alternative splicing results in multiple transcript variants encoding distinct isoforms.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human GFAP (P14136). Sequence MERRRITSAARRSYVSSGEMMVGGLAPGRRLGPGTRLSLARMPPPLPTRVDFSLAGALNAGFKETRASERAEMMELNDRFASYIEKVRFLEQQNKALAAE Gene ID Swiss Prot Synonyms ALXDRD Calculated MW 50kDa Observed MW 48kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IHC-P IF/ICC Recommended dilution - WB 1:500 - 1:2000
- IHC-P 1:50 - 1:200
- IF/ICC 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Immunofluorescence Positive samples U-251 MG, Mouse brain, Rat brain Cellular location Cytoplasm Customer validation (brain slices)
IHC(Rattus norvegicus, Homo sapiens, Mus musculus)
WB(Mus musculus, Rattus norvegicus)
WB，IF(Rattus norvegicus)
IF(Rattus norvegicus)
IF(Rattus norvegicus, Homo sapiens)
Western blot analysis of extracts of various cell lines, using GFAP antibody (A19058) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.
Western blot analysis of extracts of U-251MG cells, using GFAP antibody (A19058) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3min.
Immunohistochemistry of paraffin-embedded rat brain using GFAP Rabbit mAb (A19058) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Immunohistochemistry of paraffin-embedded human brain using GFAP Rabbit mAb (A19058) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Immunohistochemistry of paraffin-embedded mouse brain using GFAP Rabbit mAb (A19058) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Confocal imaging of mouse brain using GFAP Rabbit mAb (A19058, dilution 1:50) (Red). DAPI was used for nuclear staining (blue). Objective: 40x.
-
Key applications Western blotting, Immunohistochemistry, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human GFAP (P14136). Isotype IgG