быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
IRS1 Rabbit mAb (A19074)
- Описание
- Характеристики
-
Overview
Product name IRS1 Rabbit mAb Catalog No. A19074 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC0486 Background
This gene encodes a protein which is phosphorylated by insulin receptor tyrosine kinase. Mutations in this gene are associated with type II diabetes and susceptibility to insulin resistance.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1100-1200 of human IRS1 (P35568). Sequence SSETFSSTPSATRVGNTVPFGAGAAVGGGGGSSSSSEDVKRHSSASFENVWLRPGELGGAPKEPAKLCGAAGGLENGLNYIDLDLVKDFKQCPQECTPEPQ Gene ID Swiss Prot Synonyms HIRS-1 Calculated MW 132kDa Observed MW 170kDa Applications
Reactivity Human Tested applications WB Recommended dilution - WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples HepG2 Cellular location Caveola, Cytoplasm, Cytosol, Nucleoplasm, Nucleus, Plasma membrane Customer validation WB(Mus musculus)
IHC(Mus musculus)
Western blot analysis of extracts of HepG2 cells, using IRS1 antibody (A19074) at 1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3min. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек Immunogen A synthetic peptide corresponding to a sequence within amino acids 1100-1200 of human IRS1 (P35568). Isotype IgG