быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
TAK1 Rabbit mAb (A19077)
- Описание
- Характеристики
-
Overview
Product name TAK1 Rabbit mAb Catalog No. A19077 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC0413 Background
The protein encoded by this gene is a member of the serine/threonine protein kinase family. This kinase mediates the signaling transduction induced by TGF beta and morphogenetic protein (BMP), and controls a variety of cell functions including transcription regulation and apoptosis. In response to IL-1, this protein forms a kinase complex including TRAF6, MAP3K7P1/TAB1 and MAP3K7P2/TAB2; this complex is required for the activation of nuclear factor kappa B. This kinase can also activate MAPK8/JNK, MAP2K4/MKK4, and thus plays a role in the cell response to environmental stresses. Four alternatively spliced transcript variants encoding distinct isoforms have been reported.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 507-606 of human TAK1 (O43318). Sequence LQPLAPCPNSKESMAVFEQHCKMAQEYMKVQTEIALLLQRKQELVAELDQDEKDQQNTSRLVQEHKKLLDENKSLSTYYQQCKKQLEVIRSQQQKRQGTS Gene ID Swiss Prot Synonyms CSCF; FMD2; TAK1; MEKK7; TGF1a Calculated MW 67kDa Observed MW 75kDa Applications
Reactivity Human, Mouse Tested applications WB IP Recommended dilution - WB 1:500 - 1:2000
- IP 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunoprecipitation Positive samples 293T, HeLa, A-549, NIH/3T3, Mouse brain Cellular location Cell membrane, Cytoplasm, Peripheral membrane protein, endosome Customer validation IP(Mus musculus)
Western blot analysis of extracts of various cell lines, using TAK1 antibody (A19077) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.
Immunoprecipitation analysis of 300 μg extracts of 293T cells using 3 μg TAK1 antibody (A19077). Western blot was performed from the immunoprecipitate using TAK1 antibody (A19077) at a dilution of 1:1000.
-
Key applications Western blotting, Immunoprecipitation Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь Immunogen A synthetic peptide corresponding to a sequence within amino acids 507-606 of human TAK1 (O43318). Isotype IgG