быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
ENO2 Rabbit mAb (A19091)
- Описание
- Характеристики
-
Overview
Product name ENO2 Rabbit mAb Catalog No. A19091 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC52246 Background
This gene encodes one of the three enolase isoenzymes found in mammals. This isoenzyme, a homodimer, is found in mature neurons and cells of neuronal origin. A switch from alpha enolase to gamma enolase occurs in neural tissue during development in rats and primates.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 47-100 of human ENO2 (NP_001966.1). Sequence LELRDGDKQRYLGKGVLKAVDHINSTIAPALISSGLSVVEQEKLDNLMLELDGTENKSKFGANA Gene ID Swiss Prot Synonyms NSE; HEL-S-279 Calculated MW 47kDa Observed MW 47kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IHC-P IF/ICC Recommended dilution - WB 1:2000 - 1:10000
- IHC-P 1:50 - 1:200
- IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Immunofluorescence Positive samples HeLa, K-562, Mouse brain, Mouse heart, Mouse kidney, Rat kidney Cellular location Cell membrane, Cytoplasm 
Western blot analysis of extracts of various cell lines, using ENO2 antibody (A19091) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5s.
Immunohistochemistry analysis of paraffin-embedded mouse brain using ENO2 Rabbit mAb (A19091) at dilution of 1:50(40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded mouse spinal cord using ENO2 Rabbit mAb (A19091) at dilution of 1:50(40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Confocal imaging of Neuro-2a cells using ENO2 Rabbit mAb (A19091, dilution 1:100)(Red). The cells were counterstained with α-Tubulin Mouse mAb (AC012, dilution 1:400) (Green). DAPI was used for nuclear staining (blue). Objective: 100x.
-
Key applications Western blotting, Immunohistochemistry, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 47-100 of human ENO2 (NP_001966.1). Isotype IgG