быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
Osteopontin Rabbit mAb (A19092)
- Описание
- Характеристики
-
Overview
Product name Osteopontin Rabbit mAb Catalog No. A19092 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC0471 Background
The protein encoded by this gene is involved in the attachment of osteoclasts to the mineralized bone matrix. The encoded protein is secreted and binds hydroxyapatite with high affinity. The osteoclast vitronectin receptor is found in the cell membrane and may be involved in the binding to this protein. This protein is also a cytokine that upregulates expression of interferon-gamma and interleukin-12. Several transcript variants encoding different isoforms have been found for this gene.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 200-300 of human Osteopontin (P10451). Sequence GAYKAIPVAQDLNAPSDWDSRGKDSYETSQLDDQSAETHSHKQSRLYKRKANDESNEHSDVIDSQELSKVSREFHSHEFHSHEDMLVVDPKSKEEDKHLKF Gene ID Swiss Prot Synonyms OPN; BNSP; BSPI; ETA-1 Calculated MW 35kDa Observed MW 35kDa/65kDa Applications
Reactivity Human Tested applications WB Recommended dilution - WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples 293T, HepG2, Jurkat, U-251MG Cellular location Secreted 
Western blot analysis of extracts of various cell lines, using Osteopontin antibody (A19092) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3min. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек Immunogen A synthetic peptide corresponding to a sequence within amino acids 200-300 of human Osteopontin (P10451). Isotype IgG