быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
PAI-1/Serpin E1 Rabbit mAb (A19096)
- Описание
- Характеристики
-
Overview
Product name PAI-1/Serpin E1 Rabbit mAb Catalog No. A19096 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC0473 Background
This gene encodes a member of the serine proteinase inhibitor (serpin) superfamily. This member is the principal inhibitor of tissue plasminogen activator (tPA) and urokinase (uPA), and hence is an inhibitor of fibrinolysis. The protein also functions as a component of innate antiviral immunity. Defects in this gene are the cause of plasminogen activator inhibitor-1 deficiency (PAI-1 deficiency), and high concentrations of the gene product are associated with thrombophilia.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 50-150 of human PAI-1/Serpin E1 (P05121). Sequence SKDRNVVFSPYGVASVLAMLQLTTGGETQQQIQAAMGFKIDDKGMAPALRHLYKELMGPWNKDEISTTDAIFVQRDLKLVQGFMPHFFRLFRSTVKQVDFS Gene ID Swiss Prot Synonyms PAI; PAI1; PAI-1; PLANH1 Calculated MW 45kDa Observed MW 45kDa Applications
Reactivity Human Tested applications WB Recommended dilution - WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples HepG2 Cellular location Secreted 
Western blot analysis of extracts of HepG2 cells, using PAI-1/Serpin E1 antibody (A19096) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек Immunogen A synthetic peptide corresponding to a sequence within amino acids 50-150 of human PAI-1/Serpin E1 (P05121). Isotype IgG