быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
DJ-1/PARK7 Rabbit mAb (A19097)
- Описание
- Характеристики
-
Overview
Product name DJ-1/PARK7 Rabbit mAb Catalog No. A19097 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC0354 Background
The product of this gene belongs to the peptidase C56 family of proteins. It acts as a positive regulator of androgen receptor-dependent transcription. It may also function as a redox-sensitive chaperone, as a sensor for oxidative stress, and it apparently protects neurons against oxidative stress and cell death. Defects in this gene are the cause of autosomal recessive early-onset Parkinson disease 7. Two transcript variants encoding the same protein have been identified for this gene.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human DJ-1/PARK7 (Q99497). Sequence MASKRALVILAKGAEEMETVIPVDVMRRAGIKVTVAGLAGKDPVQCSRDVVICPDASLEDAKKEGPYDVVVLPGGNLGAQNLSESAAVKEILKEQENRKG Gene ID Swiss Prot Synonyms DJ1; DJ-1; GATD2; HEL-S-67p Calculated MW 20kDa Observed MW 23kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB Recommended dilution - WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples HeLa, SH-SY5Y, BxPC-3, HepG2, Mouse thymus, Mouse kidney, Mouse pancreas, Rat brain, Rat testis Cellular location Cell membrane, Cytoplasm, Lipid-anchor, Membrane raft, Mitochondrion, Nucleus Customer validation WB(Homo sapiens)
Western blot analysis of extracts of various cell lines, using DJ-1/PARK7 antibody (A19097) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human DJ-1/PARK7 (Q99497). Isotype IgG