быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
Parvalbumin (PVALB) Rabbit mAb (A19098)
- Описание
- Характеристики
-
Overview
Product name Parvalbumin (PVALB) Rabbit mAb Catalog No. A19098 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC0385 Background
The protein encoded by this gene is a high affinity calcium ion-binding protein that is structurally and functionally similar to calmodulin and troponin C. The encoded protein is thought to be involved in muscle relaxation. Alternative splicing results in multiple transcript variants.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-180 of human Parvalbumin (PVALB) (P20472). Sequence MSMTDLLNAEDIKKAVGAFSATDSFDHKKFFQMVGLKKKSADDVKKVFHMLDKDKSGFIEEDELGFILKGFSPDARDLSAKETKMLMAAGDKDGDGKIGVDEFSTLVAES Gene ID Swiss Prot Synonyms D22S749 Calculated MW 12kDa Observed MW 12kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IHC-P Recommended dilution - WB 1:500 - 1:1000
- IHC-P 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Positive samples Mouse skeletal muscle, Rat skeletal muscle Cellular location axon, cytoplasm, nucleus, synapse 
Western blot analysis of extracts of various cell lines, using Parvalbumin (PVALB) (PVALB) antibody (A19098) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.
Immunohistochemistry analysis of paraffin-embedded mouse brain using Parvalbumin (PVALB) (PVALB) Rabbit mAb (A19098) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded rat brain using Parvalbumin (PVALB) (PVALB) Rabbit mAb (A19098) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded human appendix using Parvalbumin (PVALB) (PVALB) Rabbit mAb (A19098) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Immunohistochemistry of paraffin-embedded human kidney using Parvalbumin (PVALB) Rabbit mAb (A19098) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
-
Key applications Western blotting, Immunohistochemistry Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-180 of human Parvalbumin (PVALB) (P20472). Isotype IgG