быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
Presenilin 1 Rabbit mAb (A19103)
- Описание
- Характеристики
-
Overview
Product name Presenilin 1 Rabbit mAb Catalog No. A19103 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC0440 Background
Alzheimer's disease (AD) patients with an inherited form of the disease carry mutations in the presenilin proteins (PSEN1; PSEN2) or in the amyloid precursor protein (APP). These disease-linked mutations result in increased production of the longer form of amyloid-beta (main component of amyloid deposits found in AD brains). Presenilins are postulated to regulate APP processing through their effects on gamma-secretase, an enzyme that cleaves APP. Also, it is thought that the presenilins are involved in the cleavage of the Notch receptor, such that they either directly regulate gamma-secretase activity or themselves are protease enzymes. Several alternatively spliced transcript variants encoding different isoforms have been identified for this gene, the full-length nature of only some have been determined.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Presenilin 1 (P49768). Sequence MTELPAPLSYFQNAQMSEDNHLSNTVRSQNDNRERQEHNDRRSLGHPEPLSNGRPQGNSRQVVEQDEEEDEELTLKYGAKHVIMLFVPVTLCMVVVVATI Gene ID Swiss Prot Synonyms AD3; FAD; PS1; PS-1; S182; PSNL1; ACNINV3 Calculated MW 53kDa Observed MW 30kDa/46kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB Recommended dilution - WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples A-431, Jurkat, U-251MG, Mouse testis, Mouse liver, Mouse brain, Rat brain Cellular location Cell membrane, Cell surface, Endoplasmic reticulum membrane, Golgi apparatus membrane, Multi-pass membrane protein Customer validation WB(Homo sapiens)

Western blot analysis of extracts of various cell lines, using Presenilin 1 antibody (A19103) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 3min. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Presenilin 1 (P49768). Isotype IgG







