быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
Serotonin transporter Rabbit mAb (A19110)
- Описание
- Характеристики
-
Overview
Product name Serotonin transporter Rabbit mAb Catalog No. A19110 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC0441 Background
This gene encodes an integral membrane protein that transports the neurotransmitter serotonin from synaptic spaces into presynaptic neurons. The encoded protein terminates the action of serotonin and recycles it in a sodium-dependent manner. This protein is a target of psychomotor stimulants, such as amphetamines and cocaine, and is a member of the sodium:neurotransmitter symporter family. A repeat length polymorphism in the promoter of this gene has been shown to affect the rate of serotonin uptake. There have been conflicting results in the literature about the possible effect, if any, that this polymorphism may play in behavior and depression.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Serotonin transporter (NP_001036.1). Sequence METTPLNSQKQLSACEDGEDCQENGVLQKVVPTPGDKVESGQISNGYSAVPSPGAGDDTRHSIPATTTTLVAELHQGERETWGKKVDFLLSVIGYAVDLG Gene ID Swiss Prot Synonyms HTT; 5HTT; OCD1; SERT; 5-HTT; SERT1; hSERT; 5-HTTLPR Calculated MW 70kDa/75kDa Observed MW 70kDa Applications
Reactivity Human, Rat Tested applications WB IF/ICC Recommended dilution - WB 1:500 - 1:1000
- IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunofluorescence Positive samples serum, A-549, HT-29, Rat brain Cellular location Cell membrane, Endomembrane system, Endosome membrane, Multi-pass membrane protein 
Western blot analysis of various lysates, using Serotonintransporter antibody (A19110) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5s.
Immunofluorescence analysis of human liver cancer using Serotonin transporter Rabbit mAb (A19110) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
-
Key applications Western blotting, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Serotonin transporter (NP_001036.1). Isotype IgG