быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
Smad5 Rabbit mAb (A19117)
- Описание
- Характеристики
-
Overview
Product name Smad5 Rabbit mAb Catalog No. A19117 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC0448 Background
The protein encoded by this gene is involved in the transforming growth factor beta signaling pathway that results in an inhibition of the proliferation of hematopoietic progenitor cells. The encoded protein is activated by bone morphogenetic proteins type 1 receptor kinase, and may be involved in cancer. Alternative splicing results in multiple transcript variants.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 200-300 of human Smad5 (Q99717). Sequence STYPNSPASSGPGSPFQLPADTPPPAYMPPDDQMGQDNSQPMDTSNNMIPQIMPSISSRDVQPVAYEEPKHWCSIVYYELNNRVGEAFHASSTSVLVDGFT Gene ID Swiss Prot Synonyms DWFC; JV5-1; MADH5 Calculated MW 52kDa Observed MW 60kDa Applications
Reactivity Human, Mouse Tested applications WB IP Recommended dilution - WB 1:500 - 1:1000
- IP 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunoprecipitation Positive samples K-562, C2C12 Cellular location Cytoplasm, Nucleus 
Western blot analysis of extracts of K-562 cells, using Smad5 antibody (A19117) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.
Western blot analysis of extracts of C2C12 cells, using Smad5 antibody (A19117) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
Immunoprecipitation analysis of 300 μg extracts of K-562 cells using 3 μg Smad5 antibody (A19117). Western blot was performed from the immunoprecipitate using Smad5 antibody (A19117) at a dilution of 1:1000.
-
Key applications Western blotting, Immunoprecipitation Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь Immunogen A synthetic peptide corresponding to a sequence within amino acids 200-300 of human Smad5 (Q99717). Isotype IgG