быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
TDP-43/TARDBP Rabbit mAb (A19123)
- Описание
- Характеристики
-
Overview
Product name TDP-43/TARDBP Rabbit mAb Catalog No. A19123 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC0492 Background
HIV-1, the causative agent of acquired immunodeficiency syndrome (AIDS), contains an RNA genome that produces a chromosomally integrated DNA during the replicative cycle. Activation of HIV-1 gene expression by the transactivator Tat is dependent on an RNA regulatory element (TAR) located downstream of the transcription initiation site. The protein encoded by this gene is a transcriptional repressor that binds to chromosomally integrated TAR DNA and represses HIV-1 transcription. In addition, this protein regulates alternate splicing of the CFTR gene. A similar pseudogene is present on chromosome 20.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 300-400 of human TDP-43/TARDB (Q13148). Sequence GNNQGSNMGGGMNFGAFSINPAMMAAAQAALQSSWGMMGMLASQQNQSGPSGNNQNQGNMQREPNQAFGSGNNSYSGSNSGAAIGWGSASNAGSGSGFNGG Gene ID Swiss Prot Synonyms ALS10; TDP-43 Calculated MW 45kDa Observed MW 35kDa/45kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IHC-P IF/ICC IP ChIP Recommended dilution - WB 1:500 - 1:2000
- IHC-P 1:50 - 1:200
- IF/ICC 1:50 - 1:200
- ChIP 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Immunofluorescence Positive samples HeLa, A549, K-562, Mouse brain, Mouse testis, Mouse thymus, Rat brain, Rat liver Cellular location Nucleus Customer validation WB(Homo sapiens )
IF(Homo sapiens )
Western blot analysis of extracts of various cell lines, using TDP-43/TARDBP Rabbit mAb (A19123) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
Immunohistochemistry analysis of paraffin-embedded mouse brain using TDP-43/TARDBP Rabbit mAb (A19123) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded rat ovary using TDP-43/TARDBP Rabbit mAb (A19123) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded human esophageal using TDP-43/TARDBP Rabbit mAb (A19123) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Immunohistochemistry of paraffin-embedded rat spleen using TDP-43/TARDBP Rabbit mAb (A19123) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry of paraffin-embedded rat liver using TDP-43/TARDBP Rabbit mAb (A19123) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry of paraffin-embedded human colon using TDP-43/TARDBP Rabbit mAb (A19123) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry of paraffin-embedded mouse colon using TDP-43/TARDBP Rabbit mAb (A19123) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry of paraffin-embedded mouse testis using TDP-43/TARDBP Rabbit mAb (A19123) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Confocal imaging of HeLa cells using TDP-43/TARDBP Rabbit mAb (A19123, dilution 1:100)(Red). The cells were counterstained with α-Tubulin Mouse mAb (AC012, dilution 1:400) (Green). DAPI was used for nuclear staining (blue). Objective: 100x.
Chromatin immunoprecipitation analysis of extracts of K562 cells, using TDP-43/TARDBP Rabbit mAb (A19123) and rabbit IgG.The amount of immunoprecipitated DNA was checked by quantitative PCR. Histogram was constructed by the ratios of the immunoprecipitated DNA to the input.
-
Key applications Western blotting, Immunohistochemistry, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 300-400 of human TDP-43/TARDB (Q13148). Isotype IgG