быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
Glycerol kinase (GK) Rabbit mAb (A19221)
- Описание
- Характеристики
-
Overview
Product name Glycerol kinase (GK) Rabbit mAb Catalog No. A19221 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC2376 Background
The protein encoded by this gene belongs to the FGGY kinase family. This protein is a key enzyme in the regulation of glycerol uptake and metabolism. It catalyzes the phosphorylation of glycerol by ATP, yielding ADP and glycerol-3-phosphate. Mutations in this gene are associated with glycerol kinase deficiency (GKD). Alternatively spliced transcript variants encoding different isoforms have been found for this gene.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 450-559 of human Glycerol kinase (GK) (P32189). Sequence IPVVKPSMPETTALGAAMAAGAAEGVGVWSLEPEDLSAVTMERFEPQINAEESEIRYSTWKKAVMKSMGWVTTQSPESGDPSIFCSLPLGFFIVSSMVMLIGARYISGIP Gene ID Swiss Prot Synonyms GK1; GKD Calculated MW 61kDa Observed MW 61kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IHC-P Recommended dilution - WB 1:500 - 1:1000
- IHC-P 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Positive samples 293T, U-87MG, Mouse testis, Rat liver, Rat testis, Rat kidney Cellular location Cytoplasm, Cytoplasmic side, Mitochondrion outer membrane, Peripheral membrane protein 
Western blot analysis of extracts of various cell lines, using Glycerol kinase (GK) (GK) antibody (A19221) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
Western blot analysis of extracts of various cell lines, using Glycerol kinase (GK) (GK) antibody (A19221) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.
Immunohistochemistry analysis of paraffin-embedded rat kidney using Glycerol kinase (GK) Rabbit mAb (A19221) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded mouse testis using Glycerol kinase (GK) Rabbit mAb (A19221) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
-
Key applications Western blotting, Immunohistochemistry Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 450-559 of human Glycerol kinase (GK) (P32189). Isotype IgG