быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
SUPT5H/SPT5 Rabbit mAb (A19225)
- Описание
- Характеристики
-
Overview
Product name SUPT5H/SPT5 Rabbit mAb Catalog No. A19225 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC2380 Background
Enables enzyme binding activity and protein heterodimerization activity. Involved in positive regulation of macroautophagy; regulation of RNA metabolic process; and transcription elongation from RNA polymerase II promoter. Located in nucleoplasm. Part of DSIF complex.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 800-900 of human SUPT5H/SPT5 (O00267). Sequence PHYGSQTPLHDGSRTPAQSGAWDPNNPNTPSRAEEEYEYAFDDEPTPSPQAYGGTPNPQTPGYPDPSSPQVNPQYNPQTPGTPAMYNTDQFSPYAAPSPQG Gene ID Swiss Prot Synonyms SPT5; SPT5H; Tat-CT1 Calculated MW 121kDa Observed MW 150kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IHC-P IF/ICC Recommended dilution - WB 1:500 - 1:1000
- IHC-P 1:50 - 1:200
- IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Immunofluorescence Positive samples HeLa Cellular location Nucleus 
Western blot analysis of extracts of HeLa cells, using SUPT5H/SPT5 antibody (A19225) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
Immunohistochemistry analysis of paraffin-embedded rat ovary using SUPT5H/SPT5 Rabbit mAb (A19225) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded human colon carcinoma using SUPT5H/SPT5 Rabbit mAb (A19225) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Immunofluorescence analysis of C6 cells using SUPT5H/SPT5 Rabbit mAb (A19225) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunofluorescence analysis of NIH/3T3 cells using SUPT5H/SPT5 Rabbit mAb (A19225) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunofluorescence analysis of U2OS cells using SUPT5H/SPT5 Rabbit mAb (A19225) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
-
Key applications Western blotting, Immunohistochemistry, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 800-900 of human SUPT5H/SPT5 (O00267). Isotype IgG