быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
LCAT Rabbit mAb (A19228)
- Описание
- Характеристики
-
Overview
Product name LCAT Rabbit mAb Catalog No. A19228 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC2383 Background
This gene encodes the extracellular cholesterol esterifying enzyme, lecithin-cholesterol acyltransferase. The esterification of cholesterol is required for cholesterol transport. Mutations in this gene have been found to cause fish-eye disease as well as LCAT deficiency.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human LCAT (P04180). Sequence MGPPGSPWQWVTLLLGLLLPPAAPFWLLNVLFPPHTTPKAELSNHTRPVILVPGCLGNQLEAKLDKPDVVNWMCYRKTEDFFTIWLDLNMFLPLGVDCWI Gene ID Swiss Prot Synonyms LCAT; lecithin-cholesterol acyltransferase Calculated MW 50kDa Observed MW 62kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB Recommended dilution - WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples Mouse plasma, Rat plasma Cellular location Secreted 
Western blot analysis of extracts of mouse plasma, using LCAT antibody (A19228) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3s.
Western blot analysis of extracts of rat plasma, using LCAT antibody (A19228) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human LCAT (P04180). Isotype IgG