быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
Eph receptor B3 (EPHB3) Rabbit mAb (A19229)
- Описание
- Характеристики
-
Overview
Product name Eph receptor B3 (EPHB3) Rabbit mAb Catalog No. A19229 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC2384 Background
Ephrin receptors and their ligands, the ephrins, mediate numerous developmental processes, particularly in the nervous system. Based on their structures and sequence relationships, ephrins are divided into the ephrin-A (EFNA) class, which are anchored to the membrane by a glycosylphosphatidylinositol linkage, and the ephrin-B (EFNB) class, which are transmembrane proteins. The Eph family of receptors are divided into two groups based on the similarity of their extracellular domain sequences and their affinities for binding ephrin-A and ephrin-B ligands. Ephrin receptors make up the largest subgroup of the receptor tyrosine kinase (RTK) family. This gene encodes a receptor for ephrin-B family members.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 50-150 of human Eph receptor B3 (EPHB3) (EPHB3) (P54753). Sequence SELAWTSHPESGWEEVSGYDEAMNPIRTYQVCNVRESSQNNWLRTGFIWRRDVQRVYVELKFTVRDCNSIPNIPGSCKETFNLFYYEADSDVASASSPFWM Gene ID Swiss Prot Synonyms EK2; ETK2; HEK2; TYRO6 Calculated MW 110kDa Observed MW 110kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB Recommended dilution - WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples HeLa, HT-29, SH-SY5Y, Mouse brain, Rat brain Cellular location Cell membrane, Cell projection, Single-pass type I membrane protein, dendrite 
Western blot analysis of extracts of various cell lines, using Eph receptor B3 (EPHB3) (EPHB3) antibody (A19229) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.
Western blot analysis of extracts of Mouse brain, using Eph receptor B3 (EPHB3) (EPHB3) antibody (A19229) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 50-150 of human Eph receptor B3 (EPHB3) (EPHB3) (P54753). Isotype IgG







