быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
LGI1 Rabbit mAb (A19230)
- Описание
- Характеристики
-
Overview
Product name LGI1 Rabbit mAb Catalog No. A19230 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC2388 Background
This gene encodes a member of the secreted leucine-rich repeat (LRR) superfamily and shares homology with members of the SLIT protein family. The encoded protein may regulate the activity of voltage-gated potassium channels and may be involved in neuronal growth regulation and cell survival. This gene is rearranged as a result of translocations in glioblastoma cell lines, and it is frequently down-regulated or rearranged in malignant gliomas. Mutations in this gene result in autosomal dominant lateral temporal epilepsy. Alternative splicing results in multiple transcript variants.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 150-250 of human LGI1 (O95970). Sequence NLQTLPKDIFKGLDSLTNVDLRGNSFNCDCKLKWLVEWLGHTNATVEDIYCEGPPEYKKRKINSLSSKDFDCIITEFAKSQDLPYQSLSIDTFSYLNDEYV Gene ID Swiss Prot Synonyms EPT; ETL1; ADLTE; ADPAEF; ADPEAF; IB1099; EPITEMPIN Calculated MW 64kDa Observed MW 64kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB Recommended dilution - WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples Mouse brain, Rat brain Cellular location Secreted, Synapse, Cytoplasm 
Western blot analysis of extracts of various cell lines, using LGI1 antibody (A19230) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 150-250 of human LGI1 (O95970). Isotype IgG