быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
RGAP1 Rabbit mAb (A19236)
- Описание
- Характеристики
-
Overview
Product name RGAP1 Rabbit mAb Catalog No. A19236 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC2394 Background
This gene encodes a GTPase-activating protein (GAP) that is a compoment of the centralspindlin complex. This protein binds activated forms of Rho GTPases and stimulates GTP hydrolysis, which results in negative regulation of Rho-mediated signals. This protein plays a regulatory role in cytokinesis, cell growth, and differentiation. Alternatively spliced transcript variants have been found for this gene. There is a pseudogene for this gene on chromosome 12.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human RGAP1 (Q9H0H5). Sequence MDTMMLNVRNLFEQLVRRVEILSEGNEVQFIQLAKDFEDFRKKWQRTDHELGKYKDLLMKAETERSALDVKLKHARNQVDVEIKRRQRAEADCEKLERQI Gene ID Swiss Prot Synonyms CYK4; CDAN3B; ID-GAP; HsCYK-4; MgcRacGAP Calculated MW 71kDa Observed MW 70kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB Recommended dilution - WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples 293T, NIH/3T3, K-562, PC-12 Cellular location Cell membrane, Cleavage furrow, Cytoplasm, Cytoplasmic side, Cytoplasmic vesicle, Midbody, Nucleus, Peripheral membrane protein, acrosome, cytoskeleton, secretory vesicle, spindle 
Western blot analysis of extracts of PC-12 cells, using RGAP1 antibody (A19236) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.
Western blot analysis of extracts of various cell lines, using RGAP1 antibody (A19236) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human RGAP1 (Q9H0H5). Isotype IgG