быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
beta glucuronidase (GUSB) Rabbit mAb (A19248)
- Описание
- Характеристики
-
Overview
Product name beta glucuronidase (GUSB) Rabbit mAb Catalog No. A19248 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC2408 Background
This gene encodes a hydrolase that degrades glycosaminoglycans, including heparan sulfate, dermatan sulfate, and chondroitin-4, 6-sulfate. The enzyme forms a homotetramer that is localized to the lysosome. Mutations in this gene result in mucopolysaccharidosis type VII. Alternative splicing results in multiple transcript variants. There are many pseudogenes of this locus in the human genome.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human beta glucuronidase (GUSB) (NP_000172.2). Sequence MARGSAVAWAALGPLLWGCALGLQGGMLYPQESPSRECKELDGLWSFRADFSDNRRRGFEEQWYRRPLWESGPTVDMPVPSSFNDISQDWRLRHFVGWVW Gene ID Swiss Prot Synonyms BG; MPS7 Calculated MW 75kDa Observed MW 75kDa Applications
Reactivity Human Tested applications WB Recommended dilution - WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples HepG2, A-549, HL-60 Cellular location Lysosome 
Western blot analysis of extracts of various cell lines, using beta glucuronidase (beta glucuronidase (GUSB)) antibody (A19248) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human beta glucuronidase (GUSB) (NP_000172.2). Isotype IgG