быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
DOK1 Rabbit mAb (A19250)
- Описание
- Характеристики
-
Overview
Product name DOK1 Rabbit mAb Catalog No. A19250 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC2410 Background
The protein encoded by this gene is part of a signal transduction pathway downstream of receptor tyrosine kinases. The encoded protein is a scaffold protein that helps form a platform for the assembly of multiprotein signaling complexes. Several transcript variants encoding different isoforms have been found for this gene.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 382-481 of human DOK1 (Q99704). Sequence EPKDAWWCQARVKEEGYELPYNPATDDYAVPPPRSTKPLLAPKPQGPAFPEPGTATGSGIKSHNSALYSQVQKSGASGSWDCGLSRVGTDKTGVKSEGST Gene ID Swiss Prot Synonyms pp62; P62DOK Calculated MW 52kDa Observed MW 62kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IF/ICC Recommended dilution - WB 1:500 - 1:1000
- IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunofluorescence Positive samples MCF7, BxPC-3 Cellular location Cytoplasm, Nucleus, perinuclear region 
Western blot analysis of extracts of various cell lines, using DOK1 antibody (A19250) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.
Immunofluorescence analysis of BALB-3T3 cells using DOK1 Rabbit mAb (A19250) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
-
Key applications Western blotting, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 382-481 of human DOK1 (Q99704). Isotype IgG