быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
PLA2G2A Rabbit mAb (A19252)
- Описание
- Характеристики
-
Overview
Product name PLA2G2A Rabbit mAb Catalog No. A19252 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC2416 Background
The protein encoded by this gene is a member of the phospholipase A2 family (PLA2). PLA2s constitute a diverse family of enzymes with respect to sequence, function, localization, and divalent cation requirements. This gene product belongs to group II, which contains secreted form of PLA2, an extracellular enzyme that has a low molecular mass and requires calcium ions for catalysis. It catalyzes the hydrolysis of the sn-2 fatty acid acyl ester bond of phosphoglycerides, releasing free fatty acids and lysophospholipids, and thought to participate in the regulation of the phospholipid metabolism in biomembranes. Several alternatively spliced transcript variants with different 5' UTRs have been found for this gene.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 65-144 of human PLA2G2A (P14555). Sequence VTHDCCYKRLEKRGCGTKFLSYKFSNSGSRITCAKQDSCRSQLCECDKAAATCFARNKTTYNKKYQYYSNKHCRGSTPRC Gene ID Swiss Prot Synonyms MOM1; PLA2; PLA2B; PLA2L; PLA2S; PLAS1; sPLA2 Calculated MW 16kDa Observed MW 15kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB Recommended dilution - WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples HT-29, HepG2, DU145, Mouse liver, Mouse spleen, Mouse small intestine, Rat spleen, Rat small intestine, Rat liver Cellular location Membrane, Peripheral membrane protein 
Western blot analysis of extracts of various cell lines, using PLA2G2A antibody (A19252) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 65-144 of human PLA2G2A (P14555). Isotype IgG