быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
SMG1 Rabbit mAb (A19253)
- Описание
- Характеристики
-
Overview
Product name SMG1 Rabbit mAb Catalog No. A19253 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC2417 Background
This gene encodes a protein involved in nonsense-mediated mRNA decay (NMD) as part of the mRNA surveillance complex. The protein has kinase activity and is thought to function in NMD by phosphorylating the regulator of nonsense transcripts 1 protein. Alternatively spliced transcript variants have been described, but their full-length nature has yet to be determined.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 3562-3661 of human SMG1 (Q96Q15). Sequence LIQKNLATSADTPPSTVPGTGKSVACSPKKAVRDPKTGKAVQERNSYAVSVWKRVKAKLEGRDVDPNRRMSVAEQVDYVIKEATNLDNLAQLYEGWTAWV Gene ID Swiss Prot Synonyms ATX; LIP; 61E3.4 Calculated MW 411kDa Observed MW 411kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB Recommended dilution - WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples C2C12, C6 Cellular location chromatoid body, cytoplasm, cytosol, nucleoplasm, nucleus 
Western blot analysis of extracts of various cell lines, using SMG1 antibody (A19253) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 3562-3661 of human SMG1 (Q96Q15). Isotype IgG