быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
Placental lactogen (CSH1) Rabbit mAb (A19258)
- Описание
- Характеристики
-
Overview
Product name Placental lactogen (CSH1) Rabbit mAb Catalog No. A19258 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC2426 Background
The protein encoded by this gene is a member of the somatotropin/prolactin family of hormones and plays an important role in growth control. The gene is located at the growth hormone locus on chromosome 17 along with four other related genes in the same transcriptional orientation; an arrangement which is thought to have evolved by a series of gene duplications. Although the five genes share a remarkably high degree of sequence identity, they are expressed selectively in different tissues. Alternative splicing generates additional isoforms of each of the five growth hormones, leading to further diversity and potential for specialization. This particular family member is expressed mainly in the placenta and utilizes multiple transcription initiation sites. Expression of the identical mature proteins for chorionic somatomammotropin hormones 1 and 2 is upregulated during development, although the ratio of 1 to 2 increases by term. Mutations in this gene result in placental lactogen deficiency and Silver-Russell syndrome.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Placental lactogen (CSH1) (CSH1) (P0DML2). Sequence MAPGSRTSLLLAFALLCLPWLQEAGAVQTVPLSRLFDHAMLQAHRAHQLAIDTYQEFEETYIPKDQKYSFLHDSQTSFCFSDSIPTPSNMEETQQKSNLE Gene ID Swiss Prot Synonyms PL; CSA; CS-1; CSMT; GHB3; hCS-1; hCS-A Calculated MW 25kDa Observed MW Refer to figures Applications
Reactivity Human Tested applications IHC-P IF/ICC Recommended dilution - IHC-P 1:50 - 1:200
- IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Immunohistochemistry Immunofluorescence Positive samples Cellular location 
Immunohistochemistry analysis of paraffin-embedded human placenta using Placental lactogen (CSH1) (CSH1) Rabbit mAb (A19258) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

Immunofluorescence analysis of human placenta using Placental lactogen (CSH1) (CSH1) Rabbit mAb (A19258) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
-
Key applications Immunohistochemistry, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Человек Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Placental lactogen (CSH1) (CSH1) (P0DML2). Isotype IgG







