быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
SERPING1 Rabbit mAb (A19259)
- Описание
- Характеристики
-
Overview
Product name SERPING1 Rabbit mAb Catalog No. A19259 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC2427 Background
This gene encodes a highly glycosylated plasma protein involved in the regulation of the complement cascade. Its encoded protein, C1 inhibitor, inhibits activated C1r and C1s of the first complement component and thus regulates complement activation. It is synthesized in the liver, and its deficiency is associated with hereditary angioneurotic oedema (HANE). Alternative splicing results in multiple transcript variants encoding the same isoform.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 150-250 of human SERPING1 (P05155). Sequence SLKLYHAFSAMKKVETNMAFSPFSIASLLTQVLLGAGENTKTNLESILSYPKDFTCVHQALKGFTTKGVTSVSQIFHSPDLAIRDTFVNASRTLYSSSPRV Gene ID Swiss Prot Synonyms C1IN; C1NH; HAE1; HAE2; C1INH Calculated MW 55kDa Observed MW 100kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB Recommended dilution - WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples Human plasma, Mouse plasma, Rat plasma Cellular location Secreted 
Western blot analysis of extracts of various cell lines, using SERPING1 antibody (A19259) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 150-250 of human SERPING1 (P05155). Isotype IgG