быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
Dynamin 3 Rabbit mAb (A19260)
- Описание
- Характеристики
-
Overview
Product name Dynamin 3 Rabbit mAb Catalog No. A19260 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC2428 Background
This gene encodes a member of a family of guanosine triphosphate (GTP)-binding proteins that associate with microtubules and are involved in vesicular transport. The encoded protein functions in the development of megakaryocytes. Alternative splicing results in multiple transcript variants.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 700-800 of human Dynamin 3 (Q9UQ16). Sequence ELLAQLYSSEDQNTLMEESAEQAQRRDEMLRMYQALKEALGIIGDISTATVSTPAPPPVDDSWIQHSRRSPPPSPTTQRRPTLSAPLARPTSGRGPAPAIP Gene ID Swiss Prot Synonyms Dyna III Calculated MW 98kDa Observed MW 100kDa Applications
Reactivity Human, Mouse Tested applications WB Recommended dilution - WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples SH-SY5Y, Mouse testis, Mouse spinal cord, Mouse brain Cellular location Cytoplasm, Cytoskeleton 
Western blot analysis of extracts of various cell lines, using Dynamin 3 antibody (A19260) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь Immunogen A synthetic peptide corresponding to a sequence within amino acids 700-800 of human Dynamin 3 (Q9UQ16). Isotype IgG