быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
PITX3 Rabbit mAb (A19261)
- Описание
- Характеристики
-
Overview
Product name PITX3 Rabbit mAb Catalog No. A19261 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC2429 Background
This gene encodes a member of the RIEG/PITX homeobox family, which is in the bicoid class of homeodomain proteins. Members of this family act as transcription factors. This protein is involved in lens formation during eye development. Mutations of this gene have been associated with anterior segment mesenchymal dysgenesis and congenital cataracts.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human PITX3 (O75364). Sequence MEFGLLSEAEARSPALSLSDAGTPHPQLPEHGCKGQEHSDSEKASASLPGGSPEDGSLKKKQRRQRTHFTSQQLQELEATFQRNRYPDMSTREEIAVWTN Gene ID Swiss Prot Synonyms ASMD; ASOD; PTX3; ASGD1; CTPP4; CTRCT11 Calculated MW 32kDa Observed MW 35kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB Recommended dilution - WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples C6, SH-SY5Y, U-87MG, Mouse eye Cellular location Nucleus 
Western blot analysis of extracts of various cell lines, using PITX3 antibody (A19261) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human PITX3 (O75364). Isotype IgG