быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
CBR1 Rabbit mAb (A19263)
- Описание
- Характеристики
-
Overview
Product name CBR1 Rabbit mAb Catalog No. A19263 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC2432 Background
The protein encoded by this gene belongs to the short-chain dehydrogenases/reductases (SDR) family, which function as NADPH-dependent oxidoreductases having wide specificity for carbonyl compounds, such as quinones, prostaglandins, and various xenobiotics. Alternatively spliced transcript variants have been found for this gene.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 178-277 of human CBR1 (P16152). Sequence DTKKGVHQKEGWPSSAYGVTKIGVTVLSRIHARKLSEQRKGDKILLNACCPGWVRTDMAGPKATKSPEEGAETPVYLALLPPDAEGPHGQFVSEKRVEQW Gene ID Swiss Prot Synonyms CBR; hCBR1; PG-9-KR; SDR21C1 Calculated MW 30kDa Observed MW 33kDa Applications
Reactivity Human, Mouse Tested applications WB IHC-P Recommended dilution - WB 1:500 - 1:1000
- IHC-P 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Positive samples 293T, A549 Cellular location Cytoplasm 
Western blot analysis of extracts of various cell lines, using CBR1 antibody (A19263) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
Immunohistochemistry analysis of paraffin-embedded mouse spinal cord using CBR1 Rabbit mAb (A19263) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
-
Key applications Western blotting, Immunohistochemistry Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь Immunogen A synthetic peptide corresponding to a sequence within amino acids 178-277 of human CBR1 (P16152). Isotype IgG