быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
Fetuin A/AHSG Rabbit mAb (A19264)
- Описание
- Характеристики
-
Overview
Product name Fetuin A/AHSG Rabbit mAb Catalog No. A19264 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC2433 Background
The protein encoded by this gene is a negatively-charged serum glycoprotein that is synthesized by hepatocytes. The encoded protein consists of two polypeptide chains, which are both cleaved from a proprotein encoded from a single mRNA. It is involved in several processes, including endocytosis, brain development, and the formation of bone tissue. Defects in this gene are a cause of susceptibility to leanness.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Fetuin A/AHSG (P02765). Sequence MKSLVLLLCLAQLWGCHSAPHGPGLIYRQPNCDDPETEEAALVAIDYINQNLPWGYKHTLNQIDEVKVWPQQPSGELFEIEIDTLETTCHVLDPTPVARC Gene ID Swiss Prot Synonyms AHS; A2HS; HSGA; APMR1; FETUA Calculated MW 39kDa Observed MW 50kDa Applications
Reactivity Human Tested applications WB Recommended dilution - WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples Human plasma Cellular location Secreted 
Western blot analysis of extracts of Human plasma, using Fetuin A/AHSG antibody (A19264) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Fetuin A/AHSG (P02765). Isotype IgG