быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
HSD3B1 Rabbit mAb (A19266)
- Описание
- Характеристики
-
Overview
Product name HSD3B1 Rabbit mAb Catalog No. A19266 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC2437 Background
The protein encoded by this gene is an enzyme that catalyzes the oxidative conversion of delta-5-3-beta-hydroxysteroid precursors into delta-4-ketosteroids, which leads to the production of all classes of steroid hormones. The encoded protein also catalyzes the interconversion of 3-beta-hydroxy- and 3-keto-5-alpha-androstane steroids.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 250-350 of human HSD3B1 (P14060). Sequence RGQFYYISDDTPHQSYDNLNYTLSKEFGLRLDSRWSFPLSLMYWIGFLLEIVSFLLRPIYTYRPPFNRHIVTLSNSVFTFSYKKAQRDLAYKPLYSWEEAK Gene ID Swiss Prot Synonyms HSD3B; HSDB3; HSDB3A; SDR11E1; 3BETAHSD Calculated MW 42kDa Observed MW 42kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IHC-P Recommended dilution - WB 1:500 - 1:1000
- IHC-P 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Positive samples Mouse liver, Rat ovary Cellular location Endoplasmic reticulum membrane, Mitochondrion membrane, Single-pass membrane protein Customer validation WB(Mus musculus, Homo sapiens)
Western blot analysis of extracts of various cell lines, using HSD3B1 antibody (A19266) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.
Immunohistochemistry analysis of paraffin-embedded rat ovary using HSD3B1 Rabbit mAb (A19266) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded human placenta using HSD3B1 Rabbit mAb (A19266) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
-
Key applications Western blotting, Immunohistochemistry Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 250-350 of human HSD3B1 (P14060). Isotype IgG