быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
JAG2 Rabbit mAb (A19267)
- Описание
- Характеристики
-
Overview
Product name JAG2 Rabbit mAb Catalog No. A19267 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC2438 Background
The Notch signaling pathway is an intercellular signaling mechanism that is essential for proper embryonic development. Members of the Notch gene family encode transmembrane receptors that are critical for various cell fate decisions. The protein encoded by this gene is one of several ligands that activate Notch and related receptors. Two transcript variants encoding different isoforms have been found for this gene.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human JAG2 (Q9Y219). Sequence MRAQGRGRLPRRLLLLLALWVQAARPMGYFELQLSALRNVNGELLSGACCDGDGRTTRAGGCGHDECDTYVRVCLKEYQAKVTPTGPCSYGHGATPVLGG Gene ID Swiss Prot Synonyms HJ2; SER2; LGMDR27 Calculated MW 133kDa Observed MW 150kDa Applications
Reactivity Human Tested applications WB Recommended dilution - WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples HeLa, RD Cellular location Membrane, Single-pass type I membrane protein 
Western blot analysis of extracts of various cell lines, using JAG2 Rabbit mAb (A19267) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human JAG2 (Q9Y219). Isotype IgG