быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
PAG1 Rabbit mAb (A19273)
- Описание
- Характеристики
-
Overview
Product name PAG1 Rabbit mAb Catalog No. A19273 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC2448 Background
The protein encoded by this gene is a type III transmembrane adaptor protein that binds to the tyrosine kinase csk protein. It is thought to be involved in the regulation of T cell activation.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 333-432 of human PAG1 (Q9NWQ8). Sequence SLTVPESTYTSIQGDPQRSPSSCNDLYATVKDFEKTPNSTLPPAGRPSEEPEPDYEAIQTLNREEEKATLGTNGHHGLVPKENDYESISDLQQGRDITRL Gene ID Swiss Prot Synonyms CBP; PAG， Calculated MW 47kDa Observed MW 76kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB Recommended dilution - WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples Raji, SH-SY5Y, Mouse brain, Mouse spleen, Rat lung, Rat brain, Rat spleen Cellular location plasma membrane 
Western blot analysis of extracts of various cell lines, using Peroxiredoxin 1 (Peroxiredoxin 1 (PAG)) antibody (A19273) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 333-432 of human PAG1 (Q9NWQ8). Isotype IgG