быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
hnRNP E1/PCBP1 Rabbit mAb (A19276)
- Описание
- Характеристики
-
Overview
Product name hnRNP E1/PCBP1 Rabbit mAb Catalog No. A19276 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC2456 Background
This intronless gene is thought to have been generated by retrotransposition of a fully processed PCBP-2 mRNA. This gene and PCBP-2 have paralogues (PCBP3 and PCBP4) which are thought to have arisen as a result of duplication events of entire genes. The protein encoded by this gene appears to be multifunctional. It along with PCBP-2 and hnRNPK corresponds to the major cellular poly(rC)-binding protein. It contains three K-homologous (KH) domains which may be involved in RNA binding. This encoded protein together with PCBP-2 also functions as translational coactivators of poliovirus RNA via a sequence-specific interaction with stem-loop IV of the IRES and promote poliovirus RNA replication by binding to its 5'-terminal cloverleaf structure. It has also been implicated in translational control of the 15-lipoxygenase mRNA, human Papillomavirus type 16 L2 mRNA, and hepatitis A virus RNA. The encoded protein is also suggested to play a part in formation of a sequence-specific alpha-globin mRNP complex which is associated with alpha-globin mRNA stability.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human PCBP1 (Q15365). Sequence MDAGVTESGLNVTLTIRLLMHGKEVGSIIGKKGESVKRIREESGARINISEGNCPERIITLTGPTNAIFKAFAMIIDKLEEDINSSMTNSTAASRPPVTL Gene ID Swiss Prot Synonyms HNRPX; HNRPE1; hnRNP-X; HEL-S-85; hnRNP-E1 Calculated MW 37kDa Observed MW 40kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB Recommended dilution - WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples HeLa, HepG2, A-431, K-562, Mouse lung, Mouse brain, Rat pancreas Cellular location Cytoplasm, Nucleus 
Western blot analysis of extracts of various cell lines, using hnRNP E1/hnRNP E1/PCBP1 antibody (A19276) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
Western blot analysis of extracts of various cell lines, using hnRNP E1/hnRNP E1/PCBP1 antibody (A19276) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human PCBP1 (Q15365). Isotype IgG







