быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
Steroidogenic factor-1 (SF-1/NR5A1) Rabbit mAb (A19277)
- Описание
- Характеристики
-
Overview
Product name Steroidogenic factor-1 (SF-1/NR5A1) Rabbit mAb Catalog No. A19277 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC2457 Background
The protein encoded by this gene is a transcriptional activator involved in sex determination. The encoded protein binds DNA as a monomer. Defects in this gene are a cause of XY sex reversal with or without adrenal failure as well as adrenocortical insufficiency without ovarian defect.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 351-461 of human Steroidogenic factor-1 (SF-1/NR5A1) (Q13285). Sequence AQELVLQLLALQLDRQEFVCLKFIILFSLDLKFLNNHILVKDAQEKANAALLDYTLCHYPHCGDKFQQLLLCLVEVRALSMQAKEYLYHKHLGNEMPRNNLLIEMLQAKQT Gene ID Swiss Prot Synonyms ELP; SF1; FTZ1; POF7; SF-1; AD4BP; FTZF1; SPGF8; SRXX4; SRXY3; hSF-1 Calculated MW 52kDa Observed MW 48kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB Recommended dilution - WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples BxPC-3, Mouse ovary, Mouse spleen Cellular location Nucleus 
Western blot analysis of extracts of various cell lines, using Steroidogenic factor-1 (SF-1/NR5A1) antibody (A19277) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 351-461 of human Steroidogenic factor-1 (SF-1/NR5A1) (Q13285). Isotype IgG