быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
ATP1A2 Rabbit mAb (A19278)
- Описание
- Характеристики
-
Overview
Product name ATP1A2 Rabbit mAb Catalog No. A19278 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC2458 Background
The protein encoded by this gene belongs to the family of P-type cation transport ATPases, and to the subfamily of Na+/K+ -ATPases. Na+/K+ -ATPase is an integral membrane protein responsible for establishing and maintaining the electrochemical gradients of Na and K ions across the plasma membrane. These gradients are essential for osmoregulation, for sodium-coupled transport of a variety of organic and inorganic molecules, and for electrical excitability of nerve and muscle. This enzyme is composed of two subunits, a large catalytic subunit (alpha) and a smaller glycoprotein subunit (beta). The catalytic subunit of Na+/K+ -ATPase is encoded by multiple genes. This gene encodes an alpha 2 subunit. Mutations in this gene result in familial basilar or hemiplegic migraines, and in a rare syndrome known as alternating hemiplegia of childhood.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human ATP1A2 (P50993). Sequence MGRGAGREYSPAATTAENGGGKKKQKEKELDELKKEVAMDDHKLSLDELGRKYQVDLSKGLTNQRAQDVLARDGPNALTPPPTTPEWVKFCRQLFGGFSI Gene ID Swiss Prot Synonyms FHM2; MHP2; DEE98; FARIMPD Calculated MW 112kDa Observed MW 100kDa Applications
Reactivity Mouse, Rat Tested applications WB Recommended dilution - WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples Mouse heart, Mouse skeletal muscle, Rat heart Cellular location Cell membrane, Membrane, Multi-pass membrane protein 
Western blot analysis of extracts of various cell lines, using ATP1A2 antibody (A19278) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human ATP1A2 (P50993). Isotype IgG







