быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
Prohibitin Rabbit mAb (A19530)
- Описание
- Характеристики
-
Overview
Product name Prohibitin Rabbit mAb Catalog No. A19530 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC0007 Background
This gene is evolutionarily conserved, and its product is proposed to play a role in human cellular senescence and tumor suppression. Antiproliferative activity is reported to be localized to the 3' UTR, which is proposed to function as a trans-acting regulatory RNA. Several pseudogenes of this gene have been identified. Alternative splicing results in multiple transcript variants.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 100-200 of human Prohibitin (P35232). Sequence ASQLPRIFTSIGEDYDERVLPSITTEILKSVVARFDAGELITQRELVSRQVSDDLTERAATFGLILDDVSLTHLTFGKEFTEAVEAKQVAQQEAERARFVV Gene ID Swiss Prot Synonyms PHB; HEL-215; HEL-S-54e Calculated MW 30kDa Observed MW 30kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IHC-P Recommended dilution - WB 1:500 - 1:1000
- IHC-P 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Positive samples U-87 MG, A549, MCF7, Mouse brain, Mouse heart, Mouse kidney, Rat heart, Rat liver, Rat kidney Cellular location Mitochondrion inner membrane 
Western blot analysis of extracts of various cell lines, using Prohibitin antibody (A19530) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5s.
Immunohistochemistry analysis of paraffin-embedded rat heart using Prohibitin antibody (A19530) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded human colon carcinoma using Prohibitin antibody (A19530) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded mouse kidney using Prohibitin antibody (A19530) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
-
Key applications Western blotting, Immunohistochemistry Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 100-200 of human Prohibitin (P35232). Isotype IgG