быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
PDGFRB Rabbit mAb (A19531)
- Описание
- Характеристики
-
Overview
Product name PDGFRB Rabbit mAb Catalog No. A19531 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC0009 Background
The protein encoded by this gene is a cell surface tyrosine kinase receptor for members of the platelet-derived growth factor family. These growth factors are mitogens for cells of mesenchymal origin. The identity of the growth factor bound to a receptor monomer determines whether the functional receptor is a homodimer (PDGFB or PDGFD) or a heterodimer (PDGFA and PDGFB). This gene is essential for normal development of the cardiovascular system and aids in rearrangement of the actin cytoskeleton. This gene is flanked on chromosome 5 by the genes for granulocyte-macrophage colony-stimulating factor and macrophage-colony stimulating factor receptor; all three genes may be implicated in the 5-q syndrome. A translocation between chromosomes 5 and 12, that fuses this gene to that of the ETV6 gene, results in chronic myeloproliferative disorder with eosinophilia.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1000-1106 of human PDGFRB (P09619). Sequence SPLDTSSVLYTAVQPNEGDNDYIIPLPDPKPEVADEGPLEGSPSLASSTLNEVNTSSTISCDSPLEPQDEPEPEPQLELQVEPEPELEQLPDSGCPAPRAEAEDSFL Gene ID Swiss Prot Synonyms IMF1; KOGS; IBGC4; JTK12; PDGFR; PENTT; CD140B; PDGFR1; PDGFR-1 Calculated MW 124kDa Observed MW 170kDa Applications
Reactivity Human, Mouse Tested applications WB IF/ICC Recommended dilution - WB 1:500 - 1:2000
- IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunofluorescence Positive samples SH-SY5Y, Mouse lung, Mouse heart, NIH/3T3 Cellular location Cell membrane, Cytoplasmic vesicle, Lysosome lumen, Single-pass type I membrane protein Customer validation WB(Mus musculus)
Western blot analysis of extracts of various cell lines, using PDGFRB antibody (A19531) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.
Immunofluorescence analysis of NIH-3T3 cells using PDGFRB antibody (A19531). Blue: DAPI for nuclear staining.
-
Key applications Western blotting, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь Immunogen A synthetic peptide corresponding to a sequence within amino acids 1000-1106 of human PDGFRB (P09619). Isotype IgG